PDB entry 2o23

View 2o23 on RCSB PDB site
Description: The structure of wild-type human HADH2 (17beta-hydroxysteroid dehydrogenase type 10) bound to NAD+ at 1.2 A
Class: oxidoreductase
Keywords: HSD17B10, SCHAD, ERAB, Type II HADH, 2-Methyl-3-hydroxybutyryl-CoA dehydrogenase, MHBD, Structural Genomics, Structural Genomics Consortium, SGC, OXIDOREDUCTASE
Deposited on 2006-11-29, released 2006-12-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.123
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HADH2 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: HADH2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6IBS9 (Start-262)
      • cloning artifact (263-264)
    Domains in SCOPe 2.03: d2o23a_
  • Chain 'B':
    Compound: HADH2 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: HADH2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6IBS9 (2-262)
      • cloning artifact (263-264)
    Domains in SCOPe 2.03: d2o23b_
  • Heterogens: NAD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o23A (A:)
    ghmaaacrsvkglvavitggasglglataerlvgqgasavlldlpnsggeaqakklgnnc
    vfapadvtsekdvqtalalakgkfgrvdvavncagiavasktynlkkgqthtledfqrvl
    dvnlmgtfnvirlvagemgqnepdqggqrgviintasvaafegqvgqaaysaskggivgm
    tlpiardlapigirvmtiapglfgtplltslpekvcnflasqvpfpsrlgdpaeyahlvq
    aiienpflngevirldgairmqpgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o23A (A:)
    rsvkglvavitggasglglataerlvgqgasavlldlpnsggeaqakklgnncvfapadv
    tsekdvqtalalakgkfgrvdvavncagiavasktynlkkgqthtledfqrvldvnlmgt
    fnvirlvagemgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtlpiard
    lapigirvmtiapglfgtpnflasqvpfpsrlgdpaeyahlvqaiienpflngevirldg
    airmqpgs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o23B (B:)
    ghmaaacrsvkglvavitggasglglataerlvgqgasavlldlpnsggeaqakklgnnc
    vfapadvtsekdvqtalalakgkfgrvdvavncagiavasktynlkkgqthtledfqrvl
    dvnlmgtfnvirlvagemgqnepdqggqrgviintasvaafegqvgqaaysaskggivgm
    tlpiardlapigirvmtiapglfgtplltslpekvcnflasqvpfpsrlgdpaeyahlvq
    aiienpflngevirldgairmqpgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o23B (B:)
    maaacrsvkglvavitggasglglataerlvgqgasavlldlpnsggeaqakklgnncvf
    apadvtsekdvqtalalakgkfgrvdvavncagiavasktynlkkgqthtledfqrvldv
    nlmgtfnvirlvagemgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtl
    piardlapigirvmtiapglfgtpllnflasqvpfpsrlgdpaeyahlvqaiienpflng
    evirldgairmqpgs