PDB entry 2o21

View 2o21 on RCSB PDB site
Description: Solution structure of the anti-apoptotic protein Bcl-2 in complex with an acyl-sulfonamide-based ligand
Class: Apoptosis
Keywords: apoptosis, complex, bcl, NMR
Deposited on 2006-11-29, released 2007-02-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apoptosis regulator Bcl-2
    Species: Homo sapiens [TaxId:9606]
    Gene: BCL2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2o21a1
  • Heterogens: 43B

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2o21A (A:)
hagrtgydnreivmkyihyklsqrgyewdagddveenrteapegtesevvhltlrqagdd
fsrryrrdfaemssqlhltpftargrfatvveelfrdgvnwgrivaffefggvmcvesvn
remsplvdnialwmteylnrhlhtwiqdnggwdafvelygpsmr