PDB entry 2o20

View 2o20 on RCSB PDB site
Description: Crystal structure of transcription regulator CcpA of Lactococcus lactis
Class: transcription
Keywords: ccpa, transcriptional regulator, helix-turn-helix, TRANSCRIPTION
Deposited on 2006-11-29, released 2007-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.177
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catabolite control protein A
    Species: Lactococcus lactis [TaxId:1358]
    Gene: ccpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CF33 (Start-331)
      • engineered (88)
    Domains in SCOPe 2.07: d2o20a_
  • Chain 'B':
    Compound: Catabolite control protein A
    Species: Lactococcus lactis [TaxId:1358]
    Gene: ccpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CF33 (Start-331)
      • engineered (88)
    Domains in SCOPe 2.07: d2o20b_
  • Chain 'C':
    Compound: Catabolite control protein A
    Species: Lactococcus lactis [TaxId:1358]
    Gene: ccpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CF33 (Start-331)
      • engineered (88)
    Domains in SCOPe 2.07: d2o20c_
  • Chain 'D':
    Compound: Catabolite control protein A
    Species: Lactococcus lactis [TaxId:1358]
    Gene: ccpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CF33 (Start-331)
      • engineered (88)
    Domains in SCOPe 2.07: d2o20d_
  • Chain 'E':
    Compound: Catabolite control protein A
    Species: Lactococcus lactis [TaxId:1358]
    Gene: ccpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CF33 (Start-331)
      • engineered (88)
    Domains in SCOPe 2.07: d2o20e_
  • Chain 'F':
    Compound: Catabolite control protein A
    Species: Lactococcus lactis [TaxId:1358]
    Gene: ccpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CF33 (Start-331)
      • engineered (88)
    Domains in SCOPe 2.07: d2o20f_
  • Chain 'G':
    Compound: Catabolite control protein A
    Species: Lactococcus lactis [TaxId:1358]
    Gene: ccpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CF33 (Start-331)
      • engineered (88)
    Domains in SCOPe 2.07: d2o20g_
  • Chain 'H':
    Compound: Catabolite control protein A
    Species: Lactococcus lactis [TaxId:1358]
    Gene: ccpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CF33 (Start-331)
      • engineered (88)
    Domains in SCOPe 2.07: d2o20h_
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o20A (A:)
    mvestttiydvarvagvsmatvsrvvngnanvkektrqkvleaiaeldyrpnavarglas
    krtttvgvilptitstyfaaitrgvddiasmykynmilansdndvekeekvletflskqv
    dgivymgssldekirtslknsrtpvvlvgtidgdkeipsvnidyhlaayqstkklidsgn
    kkiayimgslkdventermvgyqealleaniefdenlvfegnysyeqgkalaerllerga
    tsavvshdtvavgllsammdkgvkvpedfeiisganspitqytyptltsvnqplydlgav
    amrlltklmlkedveqnqlvldheifsrrstk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o20A (A:)
    rtttvgvilptitstyfaaitrgvddiasmykynmilansdndvekeekvletflskqvd
    givymgssldekirtslknsrtpvvlvgtidgdkeipsvnidyhlaayqstkklidsgnk
    kiayimgslkdventermvgyqealleaniefdenlvfegnysyeqgkalaerllergat
    savvshdtvavgllsammdkgvkvpedfeiisganspitqytyptltsvnqplydlgava
    mrlltklmlkedveqnqlvldheifsrrstk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o20B (B:)
    mvestttiydvarvagvsmatvsrvvngnanvkektrqkvleaiaeldyrpnavarglas
    krtttvgvilptitstyfaaitrgvddiasmykynmilansdndvekeekvletflskqv
    dgivymgssldekirtslknsrtpvvlvgtidgdkeipsvnidyhlaayqstkklidsgn
    kkiayimgslkdventermvgyqealleaniefdenlvfegnysyeqgkalaerllerga
    tsavvshdtvavgllsammdkgvkvpedfeiisganspitqytyptltsvnqplydlgav
    amrlltklmlkedveqnqlvldheifsrrstk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o20B (B:)
    laskrtttvgvilptitstyfaaitrgvddiasmykynmilansdndvekeekvletfls
    kqvdgivymgssldekirtslknsrtpvvlvgtidgdkeipsvnidyhlaayqstkklid
    sgnkkiayimgslkdventermvgyqealleaniefdenlvfegnysyeqgkalaerlle
    rgatsavvshdtvavgllsammdkgvkvpedfeiisganspitqytyptltsvnqplydl
    gavamrlltklmlkedveqnqlvldheifsrrstk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2o20C (C:)
    mvestttiydvarvagvsmatvsrvvngnanvkektrqkvleaiaeldyrpnavarglas
    krtttvgvilptitstyfaaitrgvddiasmykynmilansdndvekeekvletflskqv
    dgivymgssldekirtslknsrtpvvlvgtidgdkeipsvnidyhlaayqstkklidsgn
    kkiayimgslkdventermvgyqealleaniefdenlvfegnysyeqgkalaerllerga
    tsavvshdtvavgllsammdkgvkvpedfeiisganspitqytyptltsvnqplydlgav
    amrlltklmlkedveqnqlvldheifsrrstk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o20C (C:)
    tttvgvilptitstyfaaitrgvddiasmykynmilansdndvekeekvletflskqvdg
    ivymgssldekirtslknsrtpvvlvgtidgdkeipsvnidyhlaayqstkklidsgnkk
    iayimgslkdventermvgyqealleaniefdenlvfegnysyeqgkalaerllergats
    avvshdtvavgllsammdkgvkvpedfeiisganspitqytyptltsvnqplydlgavam
    rlltklmlkedveqnqlvldheifsrrstk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2o20D (D:)
    mvestttiydvarvagvsmatvsrvvngnanvkektrqkvleaiaeldyrpnavarglas
    krtttvgvilptitstyfaaitrgvddiasmykynmilansdndvekeekvletflskqv
    dgivymgssldekirtslknsrtpvvlvgtidgdkeipsvnidyhlaayqstkklidsgn
    kkiayimgslkdventermvgyqealleaniefdenlvfegnysyeqgkalaerllerga
    tsavvshdtvavgllsammdkgvkvpedfeiisganspitqytyptltsvnqplydlgav
    amrlltklmlkedveqnqlvldheifsrrstk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o20D (D:)
    tttvgvilptitstyfaaitrgvddiasmykynmilansdndvekeekvletflskqvdg
    ivymgssldekirtslknsrtpvvlvgtidgdkeipsvnidyhlaayqstkklidsgnkk
    iayimgslkdventermvgyqealleaniefdenlvfegnysyeqgkalaerllergats
    avvshdtvavgllsammdkgvkvpedfeiisganspitqytyptltsvnqplydlgavam
    rlltklmlkedveqnqlvldheifsrrstk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2o20E (E:)
    mvestttiydvarvagvsmatvsrvvngnanvkektrqkvleaiaeldyrpnavarglas
    krtttvgvilptitstyfaaitrgvddiasmykynmilansdndvekeekvletflskqv
    dgivymgssldekirtslknsrtpvvlvgtidgdkeipsvnidyhlaayqstkklidsgn
    kkiayimgslkdventermvgyqealleaniefdenlvfegnysyeqgkalaerllerga
    tsavvshdtvavgllsammdkgvkvpedfeiisganspitqytyptltsvnqplydlgav
    amrlltklmlkedveqnqlvldheifsrrstk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o20E (E:)
    rtttvgvilptitstyfaaitrgvddiasmykynmilansdndvekeekvletflskqvd
    givymgssldekirtslknsrtpvvlvgtidgdkeipsvnidyhlaayqstkklidsgnk
    kiayimgslkdventermvgyqealleaniefdenlvfegnysyeqgkalaerllergat
    savvshdtvavgllsammdkgvkvpedfeiisganspitqytyptltsvnqplydlgava
    mrlltklmlkedveqnqlvldheifsrrstk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2o20F (F:)
    mvestttiydvarvagvsmatvsrvvngnanvkektrqkvleaiaeldyrpnavarglas
    krtttvgvilptitstyfaaitrgvddiasmykynmilansdndvekeekvletflskqv
    dgivymgssldekirtslknsrtpvvlvgtidgdkeipsvnidyhlaayqstkklidsgn
    kkiayimgslkdventermvgyqealleaniefdenlvfegnysyeqgkalaerllerga
    tsavvshdtvavgllsammdkgvkvpedfeiisganspitqytyptltsvnqplydlgav
    amrlltklmlkedveqnqlvldheifsrrstk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o20F (F:)
    krtttvgvilptitstyfaaitrgvddiasmykynmilansdndvekeekvletflskqv
    dgivymgssldekirtslknsrtpvvlvgtidgdkeipsvnidyhlaayqstkklidsgn
    kkiayimgslkdventermvgyqealleaniefdenlvfegnysyeqgkalaerllerga
    tsavvshdtvavgllsammdkgvkvpedfeiisganspitqytyptltsvnqplydlgav
    amrlltklmlkedveqnqlvldheifsrrstk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2o20G (G:)
    mvestttiydvarvagvsmatvsrvvngnanvkektrqkvleaiaeldyrpnavarglas
    krtttvgvilptitstyfaaitrgvddiasmykynmilansdndvekeekvletflskqv
    dgivymgssldekirtslknsrtpvvlvgtidgdkeipsvnidyhlaayqstkklidsgn
    kkiayimgslkdventermvgyqealleaniefdenlvfegnysyeqgkalaerllerga
    tsavvshdtvavgllsammdkgvkvpedfeiisganspitqytyptltsvnqplydlgav
    amrlltklmlkedveqnqlvldheifsrrstk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o20G (G:)
    rtttvgvilptitstyfaaitrgvddiasmykynmilansdndvekeekvletflskqvd
    givymgssldekirtslknsrtpvvlvgtidgdkeipsvnidyhlaayqstkklidsgnk
    kiayimgslkdventermvgyqealleaniefdenlvfegnysyeqgkalaerllergat
    savvshdtvavgllsammdkgvkvpedfeiisganspitqytyptltsvnqplydlgava
    mrlltklmlkedveqnqlvldheifsrrstk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2o20H (H:)
    mvestttiydvarvagvsmatvsrvvngnanvkektrqkvleaiaeldyrpnavarglas
    krtttvgvilptitstyfaaitrgvddiasmykynmilansdndvekeekvletflskqv
    dgivymgssldekirtslknsrtpvvlvgtidgdkeipsvnidyhlaayqstkklidsgn
    kkiayimgslkdventermvgyqealleaniefdenlvfegnysyeqgkalaerllerga
    tsavvshdtvavgllsammdkgvkvpedfeiisganspitqytyptltsvnqplydlgav
    amrlltklmlkedveqnqlvldheifsrrstk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o20H (H:)
    krtttvgvilptitstyfaaitrgvddiasmykynmilansdndvekeekvletflskqv
    dgivymgssldekirtslknsrtpvvlvgtidgdkeipsvnidyhlaayqstkklidsgn
    kkiayimgslkdventermvgyqealleaniefdenlvfegnysyeqgkalaerllerga
    tsavvshdtvavgllsammdkgvkvpedfeiisganspitqytyptltsvnqplydlgav
    amrlltklmlkedveqnqlvldheifsrrstk