PDB entry 2o1y

View 2o1y on RCSB PDB site
Description: Solution structure of the anti-apoptotic protein Bcl-xL in complex with an acyl-sulfonamide-based ligand
Class: apoptosis
Keywords: apoptosis, complex, bcl, NMR
Deposited on 2006-11-29, released 2007-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: apoptosis regulator bcl-x
  Species: Homo sapiens [TaxId:9606]
  Gene: BCL2L1, BCL2L, BCLX
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q07817 (4-47)
    • cloning artifact (0-3)
    • cloning artifact (173-174)
    • expression tag (175-180)
  • Uniprot Q07817 (48-172)
  Domains in SCOPe 2.08: d2o1ya2, d2o1ya3, d2o1ya4
• Heterogens: 43B

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2o1yA (A:)
  msmamsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagde
  felryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvd
  kemqvlvsriaawmatylndhlepwiqenggwdtfvelygnnaaaesrkgqerlehhhhh
  h