PDB entry 2o1b

View 2o1b on RCSB PDB site
Description: Structure of aminotransferase from Staphylococcus aureus
Class: transferase
Keywords: aminotrasferase, class I, TRANSFERASE
Deposited on 2006-11-28, released 2006-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.181
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminotransferase, class I
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5HCZ0 (21-403)
      • modified residue (51)
      • modified residue (256)
      • modified residue (270)
      • modified residue (285)
      • modified residue (321)
    Domains in SCOPe 2.07: d2o1ba_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o1bA (A:)
    mgsshhhhhhssglvprgshmisnklanipdsyfgktmgrkiehgplplinmavgipdgp
    tpqgiidhfqkaltipenqkygafhgkeafkqaivdfyqrqynvtldkedevcilygtkn
    glvavptcvinpgdyvllpdpgytdylagvlladgkpvplnlepphylpdwskvdsqiid
    ktkliyltypnnptgstatkevfdeaiakfkgtdtkivhdfaygafgfdaknpsilasen
    gkdvaieiyslskgynmsgfrvgfavgnkdmiqalkkyqthtnagmfgalqdaaiyalnh
    yddfleeqsnvfktrrdrfeamlakadlpfvhakggiyvwletppgydseqfeqflvqek
    silvapgkpfgengnryvrislalddqkldeaairltelaylye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o1bA (A:)
    isnklanipdsyfgehgplplinmavgipdgptpqgiidhfqkaltipenqkygafhgke
    afkqaivdfyqrqynvtldkedevcilygtknglvavptcvinpgdyvllpdpgytdyla
    gvlladgkpvplnlepphylpdwskvdsqiidktkliyltypnnptgstatkevfdeaia
    kfkgtdtkivhdfaygafgfdaknpsilasengkdvaieiyslskgynmsgfrvgfavgn
    kdmiqalkkyqthtnagmfgalqdaaiyalnhyddfleeqsnvfktrrdrfeamlakadl
    pfvhakggiyvwletppgydseqfeqflvqeksilvapgkpfgengnryvrislalddqk
    ldeaairltelaylye