PDB entry 2o16

View 2o16 on RCSB PDB site
Description: Crystal structure of a putative acetoin utilization protein (AcuB) from Vibrio cholerae
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2006-11-28, released 2006-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetoin utilization protein AcuB, putative
    Species: Vibrio cholerae [TaxId:666]
    Gene: VC0737
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KTZ3 (3-End)
      • cloning artifact (1-2)
    Domains in SCOPe 2.07: d2o16a3, d2o16a4
  • Chain 'B':
    Compound: Acetoin utilization protein AcuB, putative
    Species: Vibrio cholerae [TaxId:666]
    Gene: VC0737
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KTZ3 (3-End)
      • cloning artifact (2)
    Domains in SCOPe 2.07: d2o16b3, d2o16b4
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o16A (A:)
    mslmikvedmmtrhphtllrthtlndakhlmealdirhvpivdankkllgivsqrdllaa
    qesslqrsaqgdslafetplfevmhtdvtsvapqaglkesaiymqkhkigclpvvakdvl
    vgiitdsdfvtiainllelqeesepdeldeeqeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o16A (A:)
    slmikvedmmtrhphtllrthtlndakhlmealdirhvpivdankkllgivsqrdllaaq
    esslqfetplfevmhtdvtsvapqaglkesaiymqkhkigclpvvakdvlvgiitdsdfv
    tiainllelqee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o16B (B:)
    mslmikvedmmtrhphtllrthtlndakhlmealdirhvpivdankkllgivsqrdllaa
    qesslqrsaqgdslafetplfevmhtdvtsvapqaglkesaiymqkhkigclpvvakdvl
    vgiitdsdfvtiainllelqeesepdeldeeqeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o16B (B:)
    lmikvedmmtrhphtllrthtlndakhlmealdirhvpivdankkllgivsqrdllaaqe
    ssslafetplfevmhtdvtsvapqaglkesaiymqkhkigclpvvakdvlvgiitdsdfv
    tiainllelqeesep