PDB entry 2o10

View 2o10 on RCSB PDB site
Description: Solution structure of the N-terminal LIM domain of MLP/CRP3
Class: metal binding protein
Keywords: LIM domain, zinc binding, CRP, MLP, METAL BINDING PROTEIN
Deposited on 2006-11-28, released 2007-12-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Muscle LIM protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CSRP3, CLP, MLP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2o10a1, d2o10a2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2o10A (A:)
gakcgacektvyhaeeiqcngrsfhktcfhcmacrkaldsttvaaheseiyckvcygrry