PDB entry 2o0r

View 2o0r on RCSB PDB site
Description: The three-dimensional structure of N-Succinyldiaminopimelate aminotransferase from Mycobacterium tuberculosis
Class: transferase
Keywords: PLP-binding Enzyme, Lysine biosynthesis, Aminotransferase, Structural Genomics, TB Structural Genomics Consortium, TBSGC, TRANSFERASE
Deposited on 2006-11-28, released 2007-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rv0858c (N-Succinyldiaminopimelate aminotransferase)
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv0858c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O53870 (2-End)
      • cloning artifact (1)
      • modified residue (232)
    Domains in SCOPe 2.07: d2o0ra1, d2o0ra2
  • Chain 'B':
    Compound: Rv0858c (N-Succinyldiaminopimelate aminotransferase)
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv0858c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O53870 (2-End)
      • cloning artifact (1)
      • modified residue (232)
    Domains in SCOPe 2.07: d2o0rb1, d2o0rb2
  • Heterogens: CL, GOL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o0rA (A:)
    matvsrlrpyattvfaemsalatrigavnlgqgfpdedgppkmlqaaqdaiaggvnqypp
    gpgsaplrraiaaqrrrhfgvdydpetevlvtvgateaiaaavlglvepgsevlliepfy
    dsyspvvamagahrvtvplvpdgrgfaldadalrravtprtraliinsphnptgavlsat
    elaaiaeiavaanlvvitdevyehlvfdharhlplagfdgmaertitissaakmfnctgw
    kigwacgpaeliagvraakqylsyvggapfqpavalaldtedawvaalrnslrarrdrla
    aglteigfavhdsygtyflcadprplgyddstefcaalpekvgvaaipmsafcdpaagqa
    sqqadvwnhlvrftfckrddtldeairrlsvlaerpatgvprglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o0rA (A:)
    atvsrlrpyattvfaemsalatrigavnlgqgfpdedgppkmlqaaqdaiaggvnqyppg
    pgsaplrraiaaqrrrhfgvdydpetevlvtvgateaiaaavlglvepgsevlliepfyd
    syspvvamagahrvtvplvpdgrgfaldadalrravtprtraliinsphnptgavlsate
    laaiaeiavaanlvvitdevyehlvfdharhlplagfdgmaertitissaakmfnctgwk
    igwacgpaeliagvraakqylsyvggapfqpavalaldtedawvaalrnslrarrdrlaa
    glteigfavhdsygtyflcadprplgyddstefcaalpekvgvaaipmsafcdpadvwnh
    lvrftfckrddtldeairrlsvlae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o0rB (B:)
    matvsrlrpyattvfaemsalatrigavnlgqgfpdedgppkmlqaaqdaiaggvnqypp
    gpgsaplrraiaaqrrrhfgvdydpetevlvtvgateaiaaavlglvepgsevlliepfy
    dsyspvvamagahrvtvplvpdgrgfaldadalrravtprtraliinsphnptgavlsat
    elaaiaeiavaanlvvitdevyehlvfdharhlplagfdgmaertitissaakmfnctgw
    kigwacgpaeliagvraakqylsyvggapfqpavalaldtedawvaalrnslrarrdrla
    aglteigfavhdsygtyflcadprplgyddstefcaalpekvgvaaipmsafcdpaagqa
    sqqadvwnhlvrftfckrddtldeairrlsvlaerpatgvprglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o0rB (B:)
    atvsrlrpyattvfaemsalatrigavnlgqgfpdedgppkmlqaaqdaiaggvnqyppg
    pgsaplrraiaaqrrrhfgvdydpetevlvtvgateaiaaavlglvepgsevlliepfyd
    syspvvamagahrvtvplvpdgrgfaldadalrravtprtraliinsphnptgavlsate
    laaiaeiavaanlvvitdevyehlvfdharhlplagfdgmaertitissaakmfnctgwk
    igwacgpaeliagvraakqylsyvggapfqpavalaldtedawvaalrnslrarrdrlaa
    glteigfavhdsygtyflcadprplgyddstefcaalpekvgvaaipmsafcdpadvwnh
    lvrftfckrddtldeairrlsvla