PDB entry 2o0p

View 2o0p on RCSB PDB site
Description: X-ray Crystal Structure of Protein CC0527 (V27M / L66M double mutant) from Caulobacter crescentus. Northeast Structural Genomics Consortium Target CcR55.
Class: structural genomics, unknown function
Keywords: PSI, PROTEIN STRUCTURE INITIATIVE, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM, NESG, Hypothetical protein CC0527
Deposited on 2006-11-27, released 2006-12-12
The last revision prior to the SCOP 1.73 freeze date was dated 2006-12-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.234
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein CC0527
    Species: Caulobacter crescentus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9AAR9 (Start-113)
      • engineered (26)
      • engineered (65)
      • cloning artifact (114)
    Domains in SCOP 1.73: d2o0pa1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o0pA (A:)
    mtliykilsraewdaakaqgrfegsamdladgfihlsageqaqetaakwfrgqanlvlla
    veaepmgedlkweasrggarfphlyrpllvsevtreadldldadgvpqlgdhlalehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o0pA (A:)
    tliykilsraewdaakaqgrfegsamdladgfihlsageqaqetaakwfrgqanlvllav
    eaepmgedlkweasrggarfphlyrpllvsevtreadldldadgvpqlgdhlal