PDB entry 2o05

View 2o05 on RCSB PDB site
Description: Human spermidine synthase
Class: transferase
Keywords: Spermidine Synthase, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2006-11-27, released 2006-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spermidine synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: SRM, SPS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2o05a1
  • Chain 'B':
    Compound: spermidine synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: SRM, SPS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2o05b_
  • Heterogens: MTA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o05A (A:)
    gsmepgpdgpaasgpaairegwfretcslwpgqalslqveqllhhrrsryqdilvfrskt
    ygnvlvldgviqcterdefsyqemianlplcshpnprkvliigggdggvlrevvkhpsve
    svvqceidedviqvskkflpgmaigyssskltlhvgdgfefmkqnqdafdviitdssdpm
    gpaeslfkesyyqlmktalkedgvlccqgecqwlhldlikemrqfcqslfpvvayaycti
    ptypsgqigfmlcsknpstnfqepvqpltqqqvaqmqlkyynsdvhraafvlpefarkal
    ndvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o05A (A:)
    airegwfretcslwpgqalslqveqllhhrrsryqdilvfrsktygnvlvldgviqcter
    defsyqemianlplcshpnprkvliigggdggvlrevvkhpsvesvvqceidedviqvsk
    kflpgmaigyssskltlhvgdgfefmkqnqdafdviitdssdpmgpaeslfkesyyqlmk
    talkedgvlccqgecqwlhldlikemrqfcqslfpvvayayctiptypsgqigfmlcskn
    pstnfqepvqpltqqqvaqmqlkyynsdvhraafvlpefarkalnd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o05B (B:)
    gsmepgpdgpaasgpaairegwfretcslwpgqalslqveqllhhrrsryqdilvfrskt
    ygnvlvldgviqcterdefsyqemianlplcshpnprkvliigggdggvlrevvkhpsve
    svvqceidedviqvskkflpgmaigyssskltlhvgdgfefmkqnqdafdviitdssdpm
    gpaeslfkesyyqlmktalkedgvlccqgecqwlhldlikemrqfcqslfpvvayaycti
    ptypsgqigfmlcsknpstnfqepvqpltqqqvaqmqlkyynsdvhraafvlpefarkal
    ndvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o05B (B:)
    airegwfretcslwpgqalslqveqllhhrrsryqdilvfrsktygnvlvldgviqcter
    defsyqemianlplcshpnprkvliigggdggvlrevvkhpsvesvvqceidedviqvsk
    kflpgmaigyssskltlhvgdgfefmkqnqdafdviitdssdpmgpaeslfkesyyqlmk
    talkedgvlccqgecqwlhldlikemrqfcqslfpvvayayctiptypsgqigfmlcskn
    pstnfqepvqpltqqqvaqmqlkyynsdvhraafvlpefarkalnd