PDB entry 2nzv

View 2nzv on RCSB PDB site
Description: Structural mechanism for the fine-tuning of CcpA function by the small molecule effectors G6P and FBP
Class: transcription
Keywords: CCpA, HPrser46-p, CCR, fructose-bis-phosphate, adjunct corepressor, LacI-GalR, TRANSCRIPTION
Deposited on 2006-11-25, released 2007-05-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: Catabolite control protein
    Species: Bacillus megaterium [TaxId:1404]
    Gene: ccpA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2nzvg_
  • Chain 'L':
    Compound: Phosphocarrier protein HPr
    Species: Bacillus megaterium [TaxId:1404]
    Gene: PTSH
    Database cross-references and differences (RAF-indexed):
    • Uniprot O69250 (Start-87)
      • modified residue (45)
    Domains in SCOPe 2.08: d2nzvl_
  • Heterogens: FBP, SO4, HOH

PDB Chain Sequences:

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2nzvG (G:)
    rglaskktttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnm
    lgkqvdgiifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqsl
    idsghkniafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieavek
    lleedekptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvq
    pmydigavamrlltkymnketvdssivqlphriefrqstk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nzvG (G:)
    kktttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqv
    dgiifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsgh
    kniafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleed
    ekptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydi
    gavamrlltkymnketvdssivqlphriefrqstk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2nzvL (L:)
    maqktftvtadsgiharpattlvqaaskfdsdinlefngktvnlksimgvmslgiqkgat
    itisaegsdeadalaaledtmskeglge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nzvL (L:)
    aqktftvtadsgiharpattlvqaaskfdsdinlefngktvnlksimgvmslgiqkgati
    tisaegsdeadalaaledtmskeglge