PDB entry 2nzu

View 2nzu on RCSB PDB site
Description: Structural mechanism for the fine-tuning of CcpA function by the small molecule effectors G6P and FBP
Class: transcription
Keywords: CcpA, CCR, HPr-Ser46-P, glucose-6-phosphate, adjunct corepressor, LacI-GalR
Deposited on 2006-11-25, released 2007-05-01
The last revision prior to the SCOP 1.73 freeze date was dated 2007-05-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.228
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: Catabolite control protein
    Species: Bacillus megaterium
    Gene: ccpA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2nzug1
  • Chain 'L':
    Compound: Phosphocarrier protein HPr
    Species: Bacillus megaterium
    Gene: PTSH
    Database cross-references and differences (RAF-indexed):
    • Uniprot O69250 (Start-87)
      • modified residue (45)
    Domains in SCOP 1.73: d2nzul1
  • Heterogens: BG6, SO4, HOH

PDB Chain Sequences:

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2nzuG (G:)
    rglaskktttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnm
    lgkqvdgiifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqsl
    idsghkniafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieavek
    lleedekptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvq
    pmydigavamrlltkymnketvdssivqlphriefrqstk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nzuG (G:)
    kktttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqv
    dgiifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsgh
    kniafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleed
    ekptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydi
    gavamrlltkymnketvdssivqlphriefrqstk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2nzuL (L:)
    maqktftvtadsgiharpattlvqaaskfdsdinlefngktvnlksimgvmslgiqkgat
    itisaegsdeadalaaledtmskeglge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nzuL (L:)
    aqktftvtadsgiharpattlvqaaskfdsdinlefngktvnlksimgvmslgiqkgati
    tisaegsdeadalaaledtmskeglge