PDB entry 2nzh

View 2nzh on RCSB PDB site
Description: Crystal structure of a secretion chaperone CsaA from Bacillus subtilis in the space group P 4 21 2
Class: chaperone
Keywords: Beta barrel, oligonucleotide/oligosaccharide binding fold, homodimer, CHAPERONE
Deposited on 2006-11-23, released 2007-03-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.202
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein csaA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: csaA, BSU19040
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2nzha_
  • Chain 'B':
    Compound: Protein csaA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: csaA, BSU19040
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2nzhb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nzhA (A:)
    gshmaviddfekldirtgtivkaeefpearvpaiklvidfgteigikqssaqitkrykpe
    glinkqviavvnfpprriagfksevlvlggipgqgdvvllqpdqpvpngtkig
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nzhA (A:)
    maviddfekldirtgtivkaeefpearvpaiklvidfgteigikqssaqitkrykpegli
    nkqviavvnfpprriagfksevlvlggipgqgdvvllqpdqpvpngtkig
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nzhB (B:)
    gshmaviddfekldirtgtivkaeefpearvpaiklvidfgteigikqssaqitkrykpe
    glinkqviavvnfpprriagfksevlvlggipgqgdvvllqpdqpvpngtkig
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nzhB (B:)
    viddfekldirtgtivkaeefpearvpaiklvidfgteigikqssaqitkrykpeglink
    qviavvnfpprriagfksevlvlggipgqgdvvllqpdqpvpngtkig