PDB entry 2nza

View 2nza on RCSB PDB site
Description: Structure and Function Studies of Cytochrome P450 158A1 from Streptomyces coelicolor A3(2)
Class: oxidoreductase
Keywords: streptomyces; Cytochrome P450 oxidoreductase; CYP158A1; flaviolin; C-C coupling activity, oxidoreductase
Deposited on 2006-11-22, released 2007-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.197
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 CYP158A1
    Species: STREPTOMYCES COELICOLOR [TaxId:100226]
    Gene: SC8F11.24c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KZF5 (Start-406)
      • expression tag (407-408)
    Domains in SCOPe 2.07: d2nzaa1, d2nzaa2
  • Chain 'B':
    Compound: Cytochrome P450 CYP158A1
    Species: STREPTOMYCES COELICOLOR [TaxId:100226]
    Gene: SC8F11.24c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KZF5 (Start-406)
      • expression tag (407-408)
    Domains in SCOPe 2.07: d2nzab1, d2nzab2
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nzaA (A:)
    mtqetttltgqspppvrdwpaldldgpefdpvlaelmregpltrvrlphgegwawlatry
    ddvkaitndprfgraevtqrqitrlaphfkprpgslafadqpdhnrlrravagaftvgat
    krlrpraqeildglvdgilaegppadlvervlepfpiavvsevmgvpaadrervhswtrq
    iistsggaeaaerakrglygwitetvraragseggdvysmlgaavgrgevgeteavglag
    plqiggeavthnvgqmlyllltrrelmarmrerpgargtaldellrwishrtsvglaria
    ledvevhgtriaagepvyvsylaanrdpdvfpdpdridldrdpnphlaygnghhfctgav
    larmqtellvdtllerlpglrlavpaeqvawrrktmirgprtlpctwhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nzaA (A:)
    pppvrdwpaldldgpefdpvlaelmregpltrvrlphgegwawlatryddvkaitndprf
    graevtqrqitrlaphfkprpgslafadqpdhnrlrravagaftvgatkrlrpraqeild
    glvdgilaegppadlvervlepfpiavvsevmgvpaadrervhswtrqiistsggaeaae
    rakrglygwitetvraragseggdvysmlgaavgrgevgeteavglagplqiggeavthn
    vgqmlyllltrrelmarmrerpgargtaldellrwishrtsvglarialedvevhgtria
    agepvyvsylaanrdpdvfpdpdridldrdpnphlaygnghhfctgavlarmqtellvdt
    llerlpglrlavpaeqvawrrktmirgprtlpctwhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nzaB (B:)
    mtqetttltgqspppvrdwpaldldgpefdpvlaelmregpltrvrlphgegwawlatry
    ddvkaitndprfgraevtqrqitrlaphfkprpgslafadqpdhnrlrravagaftvgat
    krlrpraqeildglvdgilaegppadlvervlepfpiavvsevmgvpaadrervhswtrq
    iistsggaeaaerakrglygwitetvraragseggdvysmlgaavgrgevgeteavglag
    plqiggeavthnvgqmlyllltrrelmarmrerpgargtaldellrwishrtsvglaria
    ledvevhgtriaagepvyvsylaanrdpdvfpdpdridldrdpnphlaygnghhfctgav
    larmqtellvdtllerlpglrlavpaeqvawrrktmirgprtlpctwhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nzaB (B:)
    pppvrdwpaldldgpefdpvlaelmregpltrvrlphgegwawlatryddvkaitndprf
    graevtqrqprpgslafadqpdhnrlrravagaftvgatkrlrpraqeildglvdgilae
    gppadlvervlepfpiavvsevmgvpaadrervhswtrqiistsggaeaaerakrglygw
    itetvraragseggdvysmlgaavgrgevgeteavglagplqiggeavthnvgqmlylll
    trrelmarmrerpgargtaldellrwishrtsvglarialedvevhgtriaagepvyvsy
    laanrdpdvfpdpdridldrdpnphlaygnghhfctgavlarmqtellvdtllerlpglr
    lavpaeqvawrrktmirgprtlpctwhh