PDB entry 2nz6

View 2nz6 on RCSB PDB site
Description: Crystal structure of the PTPRJ inactivating mutant C1239S
Class: hydrolase
Keywords: HYDROLASE RECEPTOR TYPE TYROSINE PHOSPHATASE J, PTPRJ, GLYCOPROTEIN, PROTEIN PHOSPHATASE, Structural Genomics, Structural Genomics Consortium, SGC, HYDROLASE
Deposited on 2006-11-22, released 2006-12-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.184
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Receptor-type tyrosine-protein phosphatase eta
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPRJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12913 (23-315)
      • expression tag (1-6)
      • cloning artifact (7-22)
      • engineered (243)
    Domains in SCOPe 2.05: d2nz6a_
  • Heterogens: NI, PO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nz6A (A:)
    mhhhhhhssgvdlgtenlyfqsmklirvenfeayfkkqqadsncgfaeeyedlklvgisq
    pkyaaelaenrgknrynnvlpydisrvklsvqthstddyinanympgyhskkdfiatqgp
    lpntlkdfwrmvweknvyaiimltkcveqgrtkceeywpskqaqdygditvamtseivlp
    ewtirdftvkniqtseshplrqfhftswpdhgvpdttdllinfrylvrdymkqsppespi
    lvhssagvgrtgtfiaidrliyqienentvdvygivydlrmhrplmvqtedqyvflnqcv
    ldivrsqkdskvdliy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nz6A (A:)
    hhhhhhssgvdlgtenlyfqsmklirvenfeayfkkqqadsncgfaeeyedlklvgisqp
    kyaaelaenrgknrynnvlpydisrvklsvqthstddyinanympgyhskkdfiatqgpl
    pntlkdfwrmvweknvyaiimltkeywpskqaqdygditvamtseivlpewtirdftvkn
    iqtseshplrqfhftswpdhgvpdttdllinfrylvrdymespilvhssagvgrtgtfia
    idrliyqienentvdvygivydlrmhrplmvqtedqyvflnqcvldivrsqkdliy