PDB entry 2nz4

View 2nz4 on RCSB PDB site
Description: Structural investigation of the GlmS ribozyme bound to its catalytic cofactor
Class: structural protein/RNA
Keywords: structural protein/RNA
Deposited on 2006-11-22, released 2007-01-16
The last revision prior to the SCOP 1.73 freeze date was dated 2007-02-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.224
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: HOMO SAPIENS
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • engineered (26)
      • engineered (31)
    Domains in SCOP 1.73: d2nz4a1
  • Chain 'B':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: HOMO SAPIENS
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012 (0-93)
      • engineered (26)
      • engineered (31)
    Domains in SCOP 1.73: d2nz4b1
  • Chain 'C':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: HOMO SAPIENS
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • engineered (26)
      • engineered (31)
    Domains in SCOP 1.73: d2nz4c1
  • Chain 'D':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: HOMO SAPIENS
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • engineered (26)
      • engineered (31)
    Domains in SCOP 1.73: d2nz4d1
  • Chain 'E':
    Compound: substrate strand RNA 13-mer
  • Chain 'F':
    Compound: substrate strand RNA 13-mer
  • Chain 'G':
    Compound: substrate strand RNA 13-mer
  • Chain 'H':
    Compound: substrate strand RNA 13-mer
  • Chain 'P':
    Compound: glms ribozyme
    Species: synthetic, synthetic
  • Chain 'Q':
    Compound: glms ribozyme
    Species: synthetic, synthetic
  • Chain 'R':
    Compound: glms ribozyme
    Species: synthetic, synthetic
  • Chain 'S':
    Compound: glms ribozyme
    Species: synthetic, synthetic
  • Heterogens: GLP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nz4A (A:)
    etrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevss
    atnalrsmqgfpfydkpmriqyaktdsdiiakmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nz4A (A:)
    rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
    nalrsmqgfpfydkpmriqyaktdsdiiak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nz4B (B:)
    etrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevss
    atnalrsmqgfpfydkpmriqyaktdsdiiakmk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2nz4C (C:)
    etrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevss
    atnalrsmqgfpfydkpmriqyaktdsdiiakmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nz4C (C:)
    pnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssatn
    alrsmqgfpfydkpmriqyaktdsdiiakm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2nz4D (D:)
    etrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevss
    atnalrsmqgfpfydkpmriqyaktdsdiiakmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nz4D (D:)
    rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
    nalrsmqgfpfydkpmriqyaktdsdiiak
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.