PDB entry 2nz1

View 2nz1 on RCSB PDB site
Description: Viral Chemokine Binding Protein M3 From Murine Gammaherpesvirus68 In Complex With The CC-Chemokine CCL2/MCP-1
Class: viral protein/cytokine
Keywords: Viral Decoy Receptor, Chemokine, Protein-Protein Complex, VIRAL PROTEIN-CYTOKINE COMPLEX
Deposited on 2006-11-22, released 2007-12-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.231
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein GAMMAHV.M3
    Species: Murid herpesvirus 4 [TaxId:33708]
    Gene: GAMMAHV.M3, M3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nz1a_
  • Chain 'B':
    Compound: Hypothetical protein GAMMAHV.M3
    Species: Murid herpesvirus 4 [TaxId:33708]
    Gene: GAMMAHV.M3, M3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nz1b_
  • Chain 'D':
    Compound: Small inducible cytokine A2
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL2, MCP1, SCYA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13500
      • engineered (63)
    Domains in SCOPe 2.07: d2nz1d_
  • Chain 'E':
    Compound: Small inducible cytokine A2
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL2, MCP1, SCYA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13500
      • engineered (63)
    Domains in SCOPe 2.07: d2nz1e_
  • Chain 'X':
    Compound: Hypothetical protein GAMMAHV.M3
    Species: Murid herpesvirus 4 [TaxId:33708]
    Gene: GAMMAHV.M3, M3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nz1x_
  • Chain 'Y':
    Compound: Small inducible cytokine A2
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL2, MCP1, SCYA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13500
      • engineered (63)
    Domains in SCOPe 2.07: d2nz1y_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nz1A (A:)
    ltlglapalsthssgvstqsvdlsqikrgdeiqahcltpaetevtecagilkdvlsknlh
    elqglcnvknkmgvpwvsveelgqeiitgrlpfpsvggtpvndlvrvlvvaesntpeetp
    eeefyayvelqtelytfglsddnvvftsdymtvwmidipksyvdvgmltratfleqwpga
    kvtvmipysstftwcgelgaiseesapqpslsarspvcknsarystskfcevdgctaetg
    mekmslltpfggppqqakmntcpcyykysvsplpamdhliladlagldsltspvyvmaay
    fdsthenpvrpssklyhcalqmtshdgvwtstsseqcpirlvegqsqnvlqvrvaptsmp
    nlvgvslmlegqqyrleyfgdh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nz1A (A:)
    hssgvstqsvdlsqikrgdeiqahcltpaetevtecagilkdvlsknlhelqglcnvknk
    mgvpwvsveelgqeiitgrlpfpsvggtpvndlvrvlvvaesntpeetpeeefyayvelq
    telytfglsddnvvftsdymtvwmidipksyvdvgmltratfleqwpgakvtvmipysst
    ftwcgelgaiseesapqpslsarspvcknsarystskfcevdgctaetgmekmslltpfg
    gppqqakmntcpcyykysvsplpamdhliladlagldsltspvyvmaayfdsthenpvrp
    ssklyhcalqmtshdgvwtstsseqcpirlvegqsqnvlqvrvaptsmpnlvgvslmleg
    qqyrleyfgdh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nz1B (B:)
    ltlglapalsthssgvstqsvdlsqikrgdeiqahcltpaetevtecagilkdvlsknlh
    elqglcnvknkmgvpwvsveelgqeiitgrlpfpsvggtpvndlvrvlvvaesntpeetp
    eeefyayvelqtelytfglsddnvvftsdymtvwmidipksyvdvgmltratfleqwpga
    kvtvmipysstftwcgelgaiseesapqpslsarspvcknsarystskfcevdgctaetg
    mekmslltpfggppqqakmntcpcyykysvsplpamdhliladlagldsltspvyvmaay
    fdsthenpvrpssklyhcalqmtshdgvwtstsseqcpirlvegqsqnvlqvrvaptsmp
    nlvgvslmlegqqyrleyfgdh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nz1B (B:)
    hssgvstqsvdlsqikrgdeiqahcltpaetevtecagilkdvlsknlhelqglcnvknk
    mgvpwvsveelgqeiitgrlpfpsvggtpvndlvrvlvvaesntpeetpeeefyayvelq
    telytfglsddnvvftsdymtvwmidipksyvdvgmltratfleqwpgakvtvmipysst
    ftwcgelgaiseesapqpslsarspvcknsarystskfcevdgctaetgmekmslltpfg
    gppqqakmntcpcyykysvsplpamdhliladlagldsltspvyvmaayfdsthenpvrp
    ssklyhcalqmtshdgvwtstsseqcpirlvegqsqnvlqvrvaptsmpnlvgvslmleg
    qqyrleyfgdh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2nz1D (D:)
    qpdainapvtccynftnrkisvqrlasyrritsskcpkeavifktivakeicadpkqkwv
    qdsidhldkqtqtpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nz1D (D:)
    pvtccynftnrkisvqrlasyrritsskcpkeavifktivakeicadpkqkwvqdsidhl
    dkqt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2nz1E (E:)
    qpdainapvtccynftnrkisvqrlasyrritsskcpkeavifktivakeicadpkqkwv
    qdsidhldkqtqtpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nz1E (E:)
    pvtccynftnrkisvqrlasyrritsskcpkeavifktivakeicadpkqkwvqdsidhl
    dkqt
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2nz1X (X:)
    ltlglapalsthssgvstqsvdlsqikrgdeiqahcltpaetevtecagilkdvlsknlh
    elqglcnvknkmgvpwvsveelgqeiitgrlpfpsvggtpvndlvrvlvvaesntpeetp
    eeefyayvelqtelytfglsddnvvftsdymtvwmidipksyvdvgmltratfleqwpga
    kvtvmipysstftwcgelgaiseesapqpslsarspvcknsarystskfcevdgctaetg
    mekmslltpfggppqqakmntcpcyykysvsplpamdhliladlagldsltspvyvmaay
    fdsthenpvrpssklyhcalqmtshdgvwtstsseqcpirlvegqsqnvlqvrvaptsmp
    nlvgvslmlegqqyrleyfgdh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nz1X (X:)
    hssgvstqsvdlsqikrgdeiqahcltpaetevtecagilkdvlsknlhelqglcnvknk
    mgvpwvsveelgqeiitgrlpfpsvggtpvndlvrvlvvaesntpeetpeeefyayvelq
    telytfglsddnvvftsdymtvwmidipksyvdvgmltratfleqwpgakvtvmipysst
    ftwcgelgaiseesapqpslsarspvcknsarystskfcevdgctaetgmekmslltpfg
    gppqqakmntcpcyykysvsplpamdhliladlagldsltspvyvmaayfdsthenpvrp
    ssklyhcalqmtshdgvwtstsseqcpirlvegqsqnvlqvrvaptsmpnlvgvslmleg
    qqyrleyfgdh
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >2nz1Y (Y:)
    qpdainapvtccynftnrkisvqrlasyrritsskcpkeavifktivakeicadpkqkwv
    qdsidhldkqtqtpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nz1Y (Y:)
    pvtccynftnrkisvqrlasyrritsskcpkeavifktivakeicadpkqkwvqdsidhl
    dkqt