PDB entry 2nyv

View 2nyv on RCSB PDB site
Description: X-ray crystal structure of a phosphoglycolate phosphatase from Aquifex aeolicus
Class: hydrolase
Keywords: phosphatase, Structural Genomics, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, HYDROLASE
Deposited on 2006-11-21, released 2006-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoglycolate phosphatase
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: gph
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67359 (3-214)
      • see remark 999 (0)
      • cloning artifact (1-2)
      • modified residue (207)
      • cloning artifact (215-216)
    Domains in SCOPe 2.07: d2nyva1, d2nyva2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nyvA (A:)
    mslrvilfdldgtlidsakdialalektlkelgleeyypdnvtkyigggvrallekvlkd
    kfreeyvevfrkhylenpvvytkpypeipytlealkskgfklavvsnkleelskkildil
    nlsgyfdlivggdtfgekkpsptpvlktleilgeepekalivgdtdadieagkragtkta
    lalwgyvklnsqipdftlsrpsdlvklmdnhivefeghhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nyvA (A:)
    mslrvilfdldgtlidsakdialalektlkelgleeyypdnvtkyigggvrallekvlkd
    kfreeyvevfrkhylenpvvytkpypeipytlealkskgfklavvsnkleelskkildil
    nlsgyfdlivggdtfgekkpsptpvlktleilgeepekalivgdtdadieagkragtkta
    lalwgyvklnsqipdftlsrpsdlvklmdnhivefeg