PDB entry 2nyr

View 2nyr on RCSB PDB site
Description: Crystal Structure of Human Sirtuin Homolog 5 in Complex with Suramin
Class: hydrolase
Keywords: histone deacetylase, structural genomics, structural genomics consortium, sgc, hydrolase
Deposited on 2006-11-21, released 2006-12-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.202
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD-dependent deacetylase sirtuin-5
    Species: Homo sapiens [TaxId:9606]
    Gene: SIRT5, SIR2L5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2nyra_
  • Chain 'B':
    Compound: NAD-dependent deacetylase sirtuin-5
    Species: Homo sapiens [TaxId:9606]
    Gene: SIRT5, SIR2L5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2nyrb_
  • Heterogens: SVR, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nyrA (A:)
    gsarpsssmadfrkffakakhiviisgagvsaesgvptfrgaggywrkwqaqdlatplaf
    ahnpsrvwefyhyrrevmgskepnaghraiaecetrlgkqgrrvvvitqnidelhrkagt
    knlleihgslfktrctscgvvaenykspicpalsgkgapepgtqdasipveklprceeag
    cggllrphvvwfgenldpaileevdrelahcdlclvvgtssvvypaamfapqvaargvpv
    aefntettpatnrfrfhfqgpcgttlpeala
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nyrA (A:)
    psssmadfrkffakakhiviisgagvsaesgvptfrgaggywrkwqaqdlatplafahnp
    srvwefyhyrrevmgskepnaghraiaecetrlgkqgrrvvvitqnidelhrkagtknll
    eihgslfktrctscgvvaenykspicpalsgkgapepgtqdasipveklprceeagcggl
    lrphvvwfgenldpaileevdrelahcdlclvvgtssvvypaamfapqvaargvpvaefn
    terfhfqgpcgttlpeala
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nyrB (B:)
    gsarpsssmadfrkffakakhiviisgagvsaesgvptfrgaggywrkwqaqdlatplaf
    ahnpsrvwefyhyrrevmgskepnaghraiaecetrlgkqgrrvvvitqnidelhrkagt
    knlleihgslfktrctscgvvaenykspicpalsgkgapepgtqdasipveklprceeag
    cggllrphvvwfgenldpaileevdrelahcdlclvvgtssvvypaamfapqvaargvpv
    aefntettpatnrfrfhfqgpcgttlpeala
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nyrB (B:)
    psssmadfrkffakakhiviisgagvsaesgvptfrgaggywrkwqaqdlatplafahnp
    srvwefyhyrrevmgskepnaghraiaecetrlgkqgrrvvvitqnidelhrkagtknll
    eihgslfktrctscgvvaenykspicpalsgkgapepgtqdasipveklprceeagcggl
    lrphvvwfgenldpaileevdrelahcdlclvvgtssvvypaamfapqvaargvpvaefn
    trfhfqgpcgttlpeala