PDB entry 2nyb

View 2nyb on RCSB PDB site
Description: Crystal structure of E.Coli Iron Superoxide Dismutase Q69E at 1.1 Angstrom resolution
Class: oxidoreductase
Keywords: Iron Superoxide Dismutase Q69E, FeSOD
Deposited on 2006-11-20, released 2006-12-05
The last revision prior to the SCOP 1.73 freeze date was dated 2007-09-04, with a file datestamp of 2007-08-31.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.16
AEROSPACI score: 0.89 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase [fe]
    Species: Escherichia coli
    Gene: sodB, b1656, JW1648
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AGD3 (0-191)
      • engineered (68)
    Domains in SCOP 1.73: d2nyba1, d2nyba2
  • Chain 'B':
    Compound: superoxide dismutase [fe]
    Species: Escherichia coli
    Gene: sodB, b1656, JW1648
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AGD3 (0-191)
      • engineered (68)
    Domains in SCOP 1.73: d2nybb1, d2nybb2
  • Chain 'C':
    Compound: superoxide dismutase [fe]
    Species: Escherichia coli
    Gene: sodB, b1656, JW1648
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AGD3 (0-191)
      • engineered (68)
    Domains in SCOP 1.73: d2nybc1, d2nybc2
  • Chain 'D':
    Compound: superoxide dismutase [fe]
    Species: Escherichia coli
    Gene: sodB, b1656, JW1648
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AGD3 (0-191)
      • engineered (68)
    Domains in SCOP 1.73: d2nybd1, d2nybd2
  • Heterogens: FE2, O, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nybA (A:)
    sfelpalpyakdalaphisaetieyhygkhhqtyvtnlnnlikgtafegksleeiirsse
    ggvfnnaaevwnhtfywnclapnaggeptgkvaeaiaasfgsfadfkaqftdaaiknfgs
    gwtwlvknsdgklaivstsnagtplttdatplltvdvwehayyidyrnarpgylehfwal
    vnwefvaknlaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nybB (B:)
    sfelpalpyakdalaphisaetieyhygkhhqtyvtnlnnlikgtafegksleeiirsse
    ggvfnnaaevwnhtfywnclapnaggeptgkvaeaiaasfgsfadfkaqftdaaiknfgs
    gwtwlvknsdgklaivstsnagtplttdatplltvdvwehayyidyrnarpgylehfwal
    vnwefvaknlaa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nybC (C:)
    sfelpalpyakdalaphisaetieyhygkhhqtyvtnlnnlikgtafegksleeiirsse
    ggvfnnaaevwnhtfywnclapnaggeptgkvaeaiaasfgsfadfkaqftdaaiknfgs
    gwtwlvknsdgklaivstsnagtplttdatplltvdvwehayyidyrnarpgylehfwal
    vnwefvaknlaa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nybD (D:)
    sfelpalpyakdalaphisaetieyhygkhhqtyvtnlnnlikgtafegksleeiirsse
    ggvfnnaaevwnhtfywnclapnaggeptgkvaeaiaasfgsfadfkaqftdaaiknfgs
    gwtwlvknsdgklaivstsnagtplttdatplltvdvwehayyidyrnarpgylehfwal
    vnwefvaknlaa