PDB entry 2ny7

View 2ny7 on RCSB PDB site
Description: HIV-1 gp120 Envelope Glycoprotein Complexed with the Broadly Neutralizing CD4-Binding-Site Antibody b12
Class: viral protein/immune system
Keywords: HIV, gp120, broadly neutralizing antibody, b12, VIRAL PROTEIN-IMMUNE SYSTEM COMPLEX
Deposited on 2006-11-20, released 2007-02-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.196
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: envelope glycoprotein gp120
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2ny7g_
  • Chain 'H':
    Compound: ANTIBODY b12, HEAVY CHAIN
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2NY7 (0-229)
    Domains in SCOPe 2.03: d2ny7h1, d2ny7h2
  • Chain 'L':
    Compound: ANTIBODY b12, LIGHT CHAIN
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2NY7 (0-214)
    Domains in SCOPe 2.03: d2ny7l1, d2ny7l2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2ny7G (G:)
    evvlvnvtenfnwckndmveqmhedicslwdqslkpcvkltplcvgagscntsvitqacp
    kvsfepipihycapagfailkcnnktfngtgpctnvstvqcthgirpvvssqlllngsla
    eeevvirscnftdnaktiivqlntsveinctgaghcniarakwnntlkqiasklreqfgn
    nktiifkqssggdpeivthwfncggeffycnstqlfnstwfnstwstegsnntegsdtit
    lpcrikqiinmwckvgkmmyappisgqircssnitgllltrdggnsnneseifrpgggdm
    rdnwrselykykvvkie
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ny7G (G:)
    evvlvnvtenfnwckndmveqmhedicslwdqslkpcvacpkvsfepipihycapagfai
    lkcnnktfngtgpctnvstvqcthgirpvvssqlllngslaeeevvirscnftdnaktii
    vqlntsveinctgaghcniarakwnntlkqiasklreqfgnnktiifkqssggdpeivth
    wfncggeffycnstqlfnstwfnstwsgsdtitlpcrikqiinmwckvgkmmyappisgq
    ircssnitgllltrdggnsnneseifrpgggdmrdnwrselykykvvkie
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ny7H (H:)
    qvqlvqsgaevkkpgasvkvscqasgyrfsnfvihwvrqapgqrfewmgwinpyngnkef
    sakfqdrvtftadtsantaymelrslrsadtavyycarvgpyswddspqdnyymdvwgkg
    ttvivssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtf
    pavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkaepksc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ny7L (L:)
    eivltqspgtlslspgeratfscrsshsirsrrvawyqhkpgqaprlvihgvsnrasgis
    drfsgsgsgtdftltitrvepedfalyycqvygassytfgqgtklerkrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglrspvtksfnrgec