PDB entry 2ny7

View 2ny7 on RCSB PDB site
Description: HIV-1 gp120 Envelope Glycoprotein Complexed with the Broadly Neutralizing CD4-Binding-Site Antibody b12
Class: viral protein/immune system
Keywords: HIV, gp120, broadly neutralizing antibody, b12
Deposited on 2006-11-20, released 2007-02-06
The last revision prior to the SCOP 1.73 freeze date was dated 2007-02-27, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.196
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: envelope glycoprotein gp120
    Species: Human immunodeficiency virus 1
  • Chain 'H':
    Compound: ANTIBODY b12, HEAVY CHAIN
    Species: HOMO SAPIENS
    Domains in SCOP 1.73: d2ny7h1, d2ny7h2
  • Chain 'L':
    Compound: ANTIBODY b12, LIGHT CHAIN
    Species: HOMO SAPIENS
    Domains in SCOP 1.73: d2ny7l1, d2ny7l2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ny7H (H:)
    qvqlvqsgaevkkpgasvkvscqasgyrfsnfvihwvrqapgqrfewmgwinpyngnkef
    sakfqdrvtftadtsantaymelrslrsadtavyycarvgpyswddspqdnyymdvwgkg
    ttvivssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtf
    pavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkaepksc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ny7L (L:)
    eivltqspgtlslspgeratfscrsshsirsrrvawyqhkpgqaprlvihgvsnrasgis
    drfsgsgsgtdftltitrvepedfalyycqvygassytfgqgtklerkrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglrspvtksfnrgec