PDB entry 2nxn

View 2nxn on RCSB PDB site
Description: T. thermophilus ribosomal protein L11 methyltransferase (PrmA) in complex with ribosomal protein L11
Class: transferase
Keywords: S-Adenosyl-L-Methionine dependent methyltransferase, post-translational modification
Deposited on 2006-11-17, released 2006-12-26
The last revision prior to the SCOP 1.75 freeze date was dated 2007-02-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.223
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosomal protein L11 methyltransferase
    Species: Thermus thermophilus
    Gene: prmA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2nxna1
  • Chain 'B':
    Compound: 50S ribosomal protein L11
    Species: Thermus thermophilus
    Gene: rplK, rpl11
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2nxnb1, d2nxnb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nxnA (A:)
    mwvyrlkgtlealdpilpglfdggarglweregevwaffpapvdlpyegvweevgdedwl
    eawrrdlkpalappfvvlapwhtwegaeiplviepgmafgtghhettrlalkalarhlrp
    gdkvldlgtgsgvlaiaaeklggkalgvdidpmvlpqaeanakrngvrprflegsleaal
    pfgpfdllvanlyaelhaalapryrealvpggralltgilkdraplvreamagagfrple
    eaaegewvllaygr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nxnA (A:)
    mwvyrlkgtlealdpilpglfdggarglweregevwaffpapvdlpyegvweevgdwlea
    wrrdlkpalappfvvlapwhtwegaeiplviepgmatghhettrlalkalarhlrpgdkv
    ldlgtgsgvlaiaaeklggkalgvdidpmvlpqaeanakrngvrprflegsleaalpfgp
    fdllvanlyaelhaalapryrealvpggralltgilkdraplvreamagagfrpleeaae
    gewvllaygr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nxnB (B:)
    mkkvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiy
    adrsftfvtktppasylirkaaglekgahkpgrekvgritweqvleiakqkmpdlnttdl
    eaaarmiagsarsmgvevvgapevkda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nxnB (B:)
    mkkvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiy
    adrsftfvtktppasylirkaaglekgahkpgrekvgritweqvleiakqkmpdlnttdl
    eaaarmiagsarsmgvevv