PDB entry 2nxc

View 2nxc on RCSB PDB site
Description: Apo-form of T. thermophilus ribosomal protein L11 methyltransferase (PrmA)
Class: Transferase
Keywords: TRANSFERASE S-Adenosly-L-Methionine dependent methyltransferase posttranslational modification, Transferase
Deposited on 2006-11-17, released 2007-02-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.194
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosomal protein L11 methyltransferase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: prmA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2nxca1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nxcA (A:)
    mwvyrlkgtlealdpilpglfdggarglweregevwaffpapvdlpyegvweevgdedwl
    eawrrdlkpalappfvvlapwhtwegaeiplviepgmafgtghhettrlalkalarhlrp
    gdkvldlgtgsgvlaiaaeklggkalgvdidpmvlpqaeanakrngvrprflegsleaal
    pfgpfdllvanlyaelhaalapryrealvpggralltgilkdraplvreamagagfrple
    eaaegewvllaygr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nxcA (A:)
    mwvyrlkgtlealdpilpglfdggarglweregevwaffpapvdlpyegvweevgdedwl
    eawrrdlkpalappfvvlapwhtwegaeiplviepgghhettrlalkalarhlrpgdkvl
    dlgtgsgvlaiaaeklggkalgvdidpmvlpqaeanakrngvrprflegsleaalpfgpf
    dllvanlyaelhaalapryrealvpggralltgilkdraplvreamagagfrpleeaaeg
    ewvllaygr