PDB entry 2nx0

View 2nx0 on RCSB PDB site
Description: Ferrous nitrosyl blackfin tuna myoglobin
Class: oxygen storage/transport
Keywords: myoglobin, NO, nitric oxide, ferrous nitrosyl, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2006-11-16, released 2007-05-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.95 Å
R-factor: 0.157
AEROSPACI score: 1.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Thunnus orientalis [TaxId:8238]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68190 (0-145)
      • conflict (110)
    Domains in SCOPe 2.04: d2nx0a_
  • Heterogens: SO4, HEM, NO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nx0A (A:)
    adfdavlkcwgpveadyttigglvltrlfkehpetqklfpkfagiaqadiagnaavsahg
    atvlkklgellkakgshaailkplanshatkhkipinnfklisevlvkvmqekagldagg
    qtalrnvmgiiiadleanykelgfsg