PDB entry 2nwt

View 2nwt on RCSB PDB site
Description: NMR Structure of Protein UPF0165 protein AF_2212 from Archaeoglobus Fulgidus; Northeast Structural Genomics Consortium Target GR83
Class: structural genomics, unknown function
Keywords: Homo Dimer Protein, GFT NMR, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2006-11-16, released 2007-01-30
The last revision prior to the SCOP 1.75 freeze date was dated 2007-01-30, with a file datestamp of 2007-07-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: UPF0165 protein AF_2212
  Species: Archaeoglobus fulgidus
  Database cross-references and differences (RAF-indexed):
  • Uniprot O28071 (0-60)
    • cloning artifact (61-62)
    • his tag (63-68)
  Domains in SCOP 1.75: d2nwta1
• Chain 'B':
  Compound: UPF0165 protein AF_2212
  Species: Archaeoglobus fulgidus
  Database cross-references and differences (RAF-indexed):
  • Uniprot O28071 (0-60)
    • cloning artifact (61-62)
    • his tag (63-68)
  Domains in SCOP 1.75: d2nwtb1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2nwtA (A:)
  mpkiieavyengvfkplqkvdlkegervkiklelkvepidlgepvsveeikkirdgtwms
  slehhhhhh
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2nwtB (B:)
  mpkiieavyengvfkplqkvdlkegervkiklelkvepidlgepvsveeikkirdgtwms
  slehhhhhh