PDB entry 2nwd

View 2nwd on RCSB PDB site
Description: Structure of chemically synthesized human lysozyme at 1 Angstrom resolution
Class: Hydrolase
Keywords: native chemical ligation, chemical protein synthesis, convergent synthesis, Hydrolase
Deposited on 2006-11-14, released 2006-12-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.04 Å
R-factor: 0.134
AEROSPACI score: 0.98 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Lysozyme C
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2nwdx1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nwdX (X:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv