PDB entry 2nw6

View 2nw6 on RCSB PDB site
Description: Burkholderia cepacia lipase complexed with S-inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: Pseudomonas cepacia lipase, racemic sec alcohols, transition state (TS) analogue, molecular modelling, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2006-11-14, released 2007-12-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.175
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipase
    Species: Burkholderia cepacia [TaxId:292]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22088 (0-319)
      • conflict (1-2)
      • conflict (17)
      • conflict (39)
      • conflict (91)
      • conflict (124)
      • conflict (136)
      • conflict (153)
      • conflict (164)
      • conflict (170)
      • conflict (217)
      • conflict (231)
      • conflict (239)
      • conflict (242)
      • conflict (255)
      • conflict (265)
      • conflict (275)
      • conflict (299)
    Domains in SCOPe 2.08: d2nw6a_
  • Heterogens: CA, NA, POT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nw6A (A:)
    adnyaatrypiilvhgltgtdkyagvleywygiqedlqqrgatvyvanlsgfqsddgpng
    rgeqllayvktvlaatgatkvnlvghsqggltsryvaavapdlvasvttigtphrgsefa
    dfvqgvlaydptglsstviaafvnvfgiltsssnntnqdalaalktlttaqaatynqnyp
    saglgapgscqtgaptetvggnthllyswagtaiqptisvfgvtgatdtstiplvdpana
    ldpstlalfgtgtvmvnrgsgqndgvvskcsalygqvlstsykwnhldeinqllgvrgan
    aedpvavirthanrlklagv