PDB entry 2nw4

View 2nw4 on RCSB PDB site
Description: Crystal Structure of the Rat Androgen Receptor Ligand Binding Domain Complex with BMS-564929
Class: hormone/growth factor
Keywords: androgen receptor, steroid receptor, nuclear receptor, transcription regulation, ligand-binding domain, hormone/growth factor complex
Deposited on 2006-11-14, released 2006-12-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.249
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Androgen receptor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Ar, Nr3c4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2nw4a_
  • Heterogens: 8NH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nw4A (A:)
    gshmiegyecqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwa
    kalpgfrnlhvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksr
    mysqcvrmrhlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeld
    riiackrknptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeii
    svqvpkilsgkvkpiyfhtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nw4A (A:)
    piflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhv
    ddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhl
    sqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknpt
    scsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgk
    vkpiyfht