PDB entry 2nw2

View 2nw2 on RCSB PDB site
Description: Crystal structure of ELS4 TCR at 1.4A
Class: immune system
Keywords: T cell receptor, IMMUNE SYSTEM
Deposited on 2006-11-14, released 2007-02-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.194
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ELS4 TCR alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2nw2a1, d2nw2a2
  • Chain 'B':
    Compound: ELS4 TCR beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2nw2b1, d2nw2b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nw2A (A:)
    qnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrfs
    sflsrskgysylllkelqmkdsasylcavqasggsyiptfgrgtslivhpyiqnpdpavy
    qlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksd
    facanafnnsiipedtffps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nw2A (A:)
    qnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrfs
    sflsrskgysylllkelqmkdsasylcavqaggsyiptfgrgtslivhpyiqnpdpavyq
    lrdskdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfac
    anafnnsiipedtffps
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nw2B (B:)
    dagitqsprhkvtetgtpvtlrchqtenhrymywyrqdpghglrlihysygvkdtdkgev
    sdgysvsrsktedflltlesatssqtsvyfcatgtgdsnqpqhfgdgtrlsiledlnkvf
    ppevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqplkeqp
    alndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawg
    rad