PDB entry 2nw0

View 2nw0 on RCSB PDB site
Description: Crystal structure of a lysin
Class: hydrolase
Keywords: Beta Barrel, HYDROLASE
Deposited on 2006-11-14, released 2006-12-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.151
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PlyB
    Species: unidentified phage [TaxId:38018]
    Gene: PlyB
    Database cross-references and differences (RAF-indexed):
    • PDB 2NW0 (0-188)
    Domains in SCOPe 2.06: d2nw0a_
  • Chain 'B':
    Compound: PlyB
    Species: unidentified phage [TaxId:38018]
    Gene: PlyB
    Database cross-references and differences (RAF-indexed):
    • PDB 2NW0 (0-188)
    Domains in SCOPe 2.06: d2nw0b_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nw0A (A:)
    gyivdmskwngspdwdtakgqldlviarvqdgsnyvdpvykdyvaamkarnipfgsyafc
    rfvsvedakveardfwnrgdkdslfwvadvevttmsdmragtqafidelyrlgakkvgly
    vghhkyeefgaaqikcdftwiprygakpaypcdlwqydeygqvpgigkcdlnrlngdksl
    dwftgkgee
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nw0B (B:)
    gyivdmskwngspdwdtakgqldlviarvqdgsnyvdpvykdyvaamkarnipfgsyafc
    rfvsvedakveardfwnrgdkdslfwvadvevttmsdmragtqafidelyrlgakkvgly
    vghhkyeefgaaqikcdftwiprygakpaypcdlwqydeygqvpgigkcdlnrlngdksl
    dwftgkgee