PDB entry 2nvn

View 2nvn on RCSB PDB site
Description: Crystal structure of a protein with a cupin-like fold and unknown function (YP_400729.1) from Synechococcus SP. PCC 7942 (Elongatus) at 2.50 A resolution
Class: Structural Genomics/Unknown function
Keywords: YP_400729.1, hypothetical protein, Structural Genomics, PSI-2, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG
Deposited on 2006-11-13, released 2006-12-12
The last revision prior to the SCOP 1.73 freeze date was dated 2006-12-12, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.209
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein
  Species: Synechococcus SP. PCC 7942
  Gene: YP_400729.1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5MZF1 (1-121)
    • modified residue (1)
    • modified residue (40)
    • modified residue (62)
  Domains in SCOP 1.73: d2nvna1
• Heterogens: GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2nvnA (A:)
  gmgrilregagwrlgwdetahrypglvgttdwaveltaaemadfcrlvqqlaetiaaiap
  elmpeerlqieaesallwleaegfadayelrlilasdrrveacwpaaavpalvaathtlk
  gf
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2nvnA (A:)
  mgrilregagwrlgwdetahrypglvgttdwaveltaaemadfcrlvqqlaetiaaiape
  lmpeerlqieaesallwleaegfadayelrlilasdrrveacwpaaavpalvaathtlkg
  f