PDB entry 2nvh

View 2nvh on RCSB PDB site
Description: Determination of Solvent Content in Cavities in Interleukin-1 Using Experimentally-Phased Electron Density
Class: cytokine
Keywords: Water; Hydration; Protein folding, CYTOKINE
Deposited on 2006-11-12, released 2006-12-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-1 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: IL1B, IL1F2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2nvha_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nvhA (A:)
    apvrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipval
    glkeknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnw
    yistsqaenmpvflggtkggqditdftmqfvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nvhA (A:)
    apvrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipval
    glkeknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnw
    yistsqaenmpvflggtkggqditdftmqfvs