PDB entry 2nv7

View 2nv7 on RCSB PDB site
Description: Crystal Structure of Estrogen Receptor Beta Complexed with WAY-555
Class: transcription
Keywords: ESTROGEN RECEPTOR, ESTROGEN RECEPTOR BETA, ER-BETA, ER, ESTROGEN, NUCLEAR RECEPTOR, TRANSCRIPTION FACTOR, AGONIST, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-11-10, released 2007-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.211
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor beta
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR2, ESTRB, NR3A2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nv7a_
  • Chain 'B':
    Compound: Estrogen receptor beta
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR2, ESTRB, NR3A2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nv7b_
  • Chain 'C':
    Compound: Nuclear receptor coactivator 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Nuclear receptor coactivator 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 555, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nv7A (A:)
    lspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfvel
    slfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmlla
    ttsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklahllnavtdalvwvia
    ksgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlnahvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nv7A (A:)
    lspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfvel
    slfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmlla
    ttsrfrelklqhkeylcvkamillnssmdssrklahllnavtdalvwviaksgissqqqs
    mrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlnahvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nv7B (B:)
    lspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfvel
    slfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmlla
    ttsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklahllnavtdalvwvia
    ksgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlnahvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nv7B (B:)
    lspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfvel
    slfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmlla
    ttsrfrelklqhkeylcvkamillnssmdssrklahllnavtdalvwviaksgissqqqs
    mrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlna
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.