PDB entry 2nv6

View 2nv6 on RCSB PDB site
Description: Mycobacterium tuberculosis InhA (S94A) bound with INH-NAD adduct
Class: oxidoreductase
Keywords: InhA, S94A, tuberculosis, isoniazid, OXIDOREDUCTASE
Deposited on 2006-11-10, released 2006-11-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.201
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: inhA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A5Y6 (0-267)
      • engineered (0)
      • engineered (92)
    Domains in SCOPe 2.06: d2nv6a_
  • Heterogens: ZID, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nv6A (A:)
    aglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
    eldvqneehlaslagrvteaigagnkldgvvhaigfmpqtgmginpffdapyadvskgih
    isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
    ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt
    vcallsdwlpattgdiiyadggahtqll