PDB entry 2nuo

View 2nuo on RCSB PDB site
Description: Crystal structure of a complex of griffithsin with glucose
Class: sugar binding protein
Keywords: griffithsin, lectins, domain swapping, mannose binding, HIV, SARS, SUGAR BINDING PROTEIN
Deposited on 2006-11-09, released 2007-08-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Griffithsin
    Species: Griffithsia [TaxId:35158]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2nuoa1
  • Chain 'B':
    Compound: Griffithsin
    Species: Griffithsia [TaxId:35158]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2nuob1
  • Heterogens: BGC, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2nuoA (A:)
slthrkfggsggspfsglssiavrsgsyldaiiidgvhhggsggnlsptftfgsgeyisn
mtirsgdyidnisfetnmgrrfgpyggsggsantlsnvkviqingsagdyldsldiyyeq
y

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2nuoB (B:)
slthrkfggsggspfsglssiavrsgsyldaiiidgvhhggsggnlsptftfgsgeyisn
mtirsgdyidnisfetnmgrrfgpyggsggsantlsnvkviqingsagdyldsldiyyeq
y