PDB entry 2nun

View 2nun on RCSB PDB site
Description: The structure of the type III effector AvrB complexed with ADP
Class: toxin/protein binding
Keywords: type III effector, AvrB, nuclotide, pocket, ADP, TOXIN/PROTEIN BINDING COMPLEX
Deposited on 2006-11-09, released 2007-05-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.232
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avirulence B protein
    Species: Pseudomonas syringae pv. glycinea [TaxId:318]
    Gene: AVRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2nuna_
  • Heterogens: ADP, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nunA (A:)
    gamgcvssksttvlspqtsfneasrtsfralpgpsqrqlevydqcligaarwpddssksn
    tpenraycqsmynsirsagdeisrggitsfeelwgratewrlsklqrgeplysafasert
    sdtdavtplvkpyksvlarvvdhedahdeimqdnlfgdlnvkvyrqtaylhgnviplntf
    rvatdteylrdrvahlrtelgakalkqhlqrynpdridhtnasylpiikdhlndlyrqai
    ssdlsqaelisliarthwwaasampdqrgsaakaefaaraiasahgielppfrngnvsdi
    eamlsgeeefvekyrslldsdcf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nunA (A:)
    tsfneasrtsfralpgpsqrqlevydqcligaarwpddsntpenraycqsmynsirsagd
    eisrggitsfeelwgratewrlsklqrgeplysafasertsdtdavtplvkpyksvlarv
    vdhedahdeimqdnlfgdlnvkvyrqtaylhgnviplntfrvatdteylrdrvahlrtel
    gakalkqhlqrynpdridhtnasylpiikdhlndlyrqaissdlsqaelisliarthwwa
    asampdqrgsaakaefaaraiasahgielppfrngnvsdieamlsgeeefvekyrsllds
    d