PDB entry 2nul

View 2nul on RCSB PDB site
Description: peptidylprolyl isomerase from e. coli
Class: isomerase
Keywords: isomerase, rotamase
Deposited on 1996-11-14, released 1997-11-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.16
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidylprolyl isomerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2nula_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nulA (A:)
    mvtfhtnhgdiviktfddkapetvknfldycregfynntifhrvingfmiqgggfepgmk
    qkatkepikneannglkntrgtlamartqaphsataqffinvvdndflnfsgeslqgwgy
    cvfaevvdgmdvvdkikgvatgrsgmhqdvpkedviiesvtvse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nulA (A:)
    mvtfhtnhgdiviktfddkapetvknfldycregfynntifhrvingfmiqgggfepgmk
    qkatkepikneannglkntrgtlamartqaphsataqffinvvdndflnfsgeslqgwgy
    cvfaevvdgmdvvdkikgvatgrsgmhqdvpkedviiesvtvs