PDB entry 2nul

View 2nul on RCSB PDB site
Description: peptidylprolyl isomerase from e. coli
Deposited on 1996-11-14, released 1997-11-19
The last revision prior to the SCOP 1.55 freeze date was dated 1997-11-19, with a file datestamp of 1997-11-19.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.16
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d2nul__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nul_ (-)
    mvtfhtnhgdiviktfddkapetvknfldycregfynntifhrvingfmiqgggfepgmk
    qkatkepikneannglkntrgtlamartqaphsataqffinvvdndflnfsgeslqgwgy
    cvfaevvdgmdvvdkikgvatgrsgmhqdvpkedviiesvtvs