PDB entry 2nuj

View 2nuj on RCSB PDB site
Description: Crystal structure of thioesterase superfamily (YP_509914.1) from Jannaschia Sp. CCS1 at 2.00 A resolution
Class: hydrolase
Keywords: YP_509914.1, thioesterase superfamily, Structural Genomics, PSI-2, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG, Hydrolase
Deposited on 2006-11-09, released 2006-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioesterase superfamily
    Species: Jannaschia [TaxId:188905]
    Gene: YP_509914.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q28QX3
      • modified residue (88)
      • modified residue (90)
      • modified residue (110)
    Domains in SCOPe 2.07: d2nuja1
  • Chain 'B':
    Compound: Thioesterase superfamily
    Species: Jannaschia [TaxId:188905]
    Gene: YP_509914.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q28QX3
      • modified residue (88)
      • modified residue (90)
      • modified residue (110)
    Domains in SCOPe 2.07: d2nujb1
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nujA (A:)
    gmtlppyhtplpaetlralsipapwtfgladrvrfgeldaighvnhtaylrwyesfrlpf
    lkarhvtdygptsprlvlkqvhctylaemgmgedyvitgrvsnfrttsftmefacwrlgd
    avectsegsavvvllnrdgsgrypipeagrasfvtedgvlaag
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nujA (A:)
    lppyhtplpaetlralsipapwtfgladrvrfgeldaighvnhtaylrwyesfrlpflka
    rhvtdygptsprlvlkqvhctylaemgmgedyvitgrvsnfrttsftmefacwrlgdave
    ctsegsavvvllnrdgsgrypipeagrasfvtedgvlaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nujB (B:)
    gmtlppyhtplpaetlralsipapwtfgladrvrfgeldaighvnhtaylrwyesfrlpf
    lkarhvtdygptsprlvlkqvhctylaemgmgedyvitgrvsnfrttsftmefacwrlgd
    avectsegsavvvllnrdgsgrypipeagrasfvtedgvlaag
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nujB (B:)
    lppyhtplpaetlralsipapwtfgladrvrfgeldaighvnhtaylrwyesfrlpflka
    rhvtdygptsprlvlkqvhctylaemgmgedyvitgrvsnfrttsftmefacwrlgdave
    ctsegsavvvllnrdgsgrypipeagrasfvtedgvlaa