PDB entry 2nuf

View 2nuf on RCSB PDB site
Description: Crystal structure of RNase III from Aquifex aeolicus complexed with ds-RNA at 2.5-Angstrom Resolution
Class: hydrolase/RNA
Keywords: Ribonuclease III, dsRNA, RNA interference, endonucleolytic cleavage, hydrolase-RNA COMPLEX
Deposited on 2006-11-09, released 2007-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease III
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: rnc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nufa1, d2nufa2
  • Chain 'B':
    Compound: Ribonuclease III
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: rnc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nufb1, d2nufb2
  • Chain 'C':
    Compound: 28-mer
  • Chain 'D':
    Compound: 28-mer
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nufA (A:)
    mkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqysp
    nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyids
    grdanftrelfyklfkedilsaikegrvkkdyktilqeitqkrwkerpeyrlisvegphh
    kkkfiveakikeyrtlgegkskkeaeqraaeeliklleese
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nufA (A:)
    kmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqyspn
    kregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyidsg
    rdanftrelfyklfkedilsaikegrvkkdyktilqeitqkrwkerpeyrlisvegphhk
    kkfiveakikeyrtlgegkskkeaeqraaeelikllees
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nufB (B:)
    mkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqysp
    nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyids
    grdanftrelfyklfkedilsaikegrvkkdyktilqeitqkrwkerpeyrlisvegphh
    kkkfiveakikeyrtlgegkskkeaeqraaeeliklleese
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nufB (B:)
    kmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqyspn
    kregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyidsg
    rdanftrelfyklfkedilsaikegrvkkdyktilqeitqkrwkerpeyrlisvegphhk
    kkfiveakikeyrtlgegkskkeaeqraaeelikllees
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.