PDB entry 2nud

View 2nud on RCSB PDB site
Description: The structure of the type III effector AvrB complexed with a high-affinity RIN4 peptide
Class: toxin/protein binding
Keywords: AvrB RIN4 high-affinity crystal structure, TOXIN/PROTEIN BINDING COMPLEX
Deposited on 2006-11-09, released 2007-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.21
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avirulence B protein
    Species: Pseudomonas savastanoi [TaxId:318]
    Gene: AVRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nuda1
  • Chain 'B':
    Compound: Avirulence B protein
    Species: Pseudomonas savastanoi [TaxId:318]
    Gene: AVRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nudb1
  • Chain 'C':
    Compound: RPM1-interacting protein 4
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: RPM1-interacting protein 4
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: TRS, ETF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nudA (A:)
    gamgcvssksttvlspqtsfneasrtsfralpgpsqrqlevydqcligaarwpddssksn
    tpenraycqsmynsirsagdeisrggitsfeelwgratewrlsklqrgeplysafasert
    sdtdavtplvkpyksvlarvvdhedahdeimqdnlfgdlnvkvyrqtaylhgnviplntf
    rvatdteylrdrvahlrtelgakalkqhlqrynpdridhtnasylpiikdhlndlyrqai
    ssdlsqaelisliarthwwaasampdqrgsaakaefaaraiasahgielppfrngnvsdi
    eamlsgeeefvekyrslldsdcf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nudA (A:)
    fralpgpsqrqlevydqcligaarwpddksntpenraycqsmynsirsagdeisrggits
    feelwgratewrlskleplysafasertsdtdavtplvkpyksvlarvvdhedahdeimq
    dnlfgdlnvkvyrqtaylhgnviplntfrvatdteylrdrvahlrtelgakalkqhlqry
    npdridhtnasylpiikdhlndlyrqaissdlsqaelisliarthwwaasampdqrgsaa
    kaefaaraiasahgielppfrngnvsdieamlsgeeefvekyrslldsdcf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nudB (B:)
    gamgcvssksttvlspqtsfneasrtsfralpgpsqrqlevydqcligaarwpddssksn
    tpenraycqsmynsirsagdeisrggitsfeelwgratewrlsklqrgeplysafasert
    sdtdavtplvkpyksvlarvvdhedahdeimqdnlfgdlnvkvyrqtaylhgnviplntf
    rvatdteylrdrvahlrtelgakalkqhlqrynpdridhtnasylpiikdhlndlyrqai
    ssdlsqaelisliarthwwaasampdqrgsaakaefaaraiasahgielppfrngnvsdi
    eamlsgeeefvekyrslldsdcf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nudB (B:)
    fralpgpsqrqlevydqcligaarwpddksntpenraycqsmynsirsagdeisrggits
    feelwgratewrlskleplysafasertsdtdavtplvkpyksvlarvvdhedahdeimq
    dnlfgdlnvkvyrqtaylhgnviplntfrvatdteylrdrvahlrtelgakalkqhlqry
    npdridhtnasylpiikdhlndlyrqaissdlsqaelisliarthwwaasampdqrgsaa
    kaefaaraiasahgielppfrngnvsdieamlsgeeefvekyrslldsdcf
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.