PDB entry 2nub

View 2nub on RCSB PDB site
Description: Structure of Aquifex aeolicus Argonuate
Class: signaling protein
Keywords: RNAseH, Argonaute, ribonuclease, RNAi, RISC
Deposited on 2006-11-09, released 2007-02-06
The last revision prior to the SCOP 1.73 freeze date was dated 2007-02-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.234
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Argonaute
    Species: Aquifex aeolicus
    Gene: Argonaute
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2nuba1, d2nuba2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nubA (A:)
    mgkeallnlyrieyrpkdttftvfkptheiqkeklnkvrwrvflqtglptfrredefwca
    gkvekdtlyltlsngeivelkrvgeeefrgfqnerecqelfrdfltktkvkdkfisdfyk
    kfrdkitvqgknrkialipevnekvlkseegyfllhldlkfriqpfetlqtllerndfnp
    krirvkpigidfvgrvqdvfkakekgeeffrlcmersthksskkaweellknrelrekaf
    lvvlekgytypatilkpvltyenledeernevadivrmepgkrlnliryilrryvkalrd
    ygwyispeeerakgklnfkdtvldakgkntkvitnlrkflelcrpfvkkdvlsveiisvs
    vykklewrkeeflkelinflknkgiklkikgkslilaqtreeakeklipvinkikdvdlv
    ivfleeypkvdpyksfllydfvkrellkkmipsqvilnrtlknenlkfvllnvaeqvlak
    tgnipyklkeiegkvdafvgidisritrdgktvnavaftkifnskgelvryyltsypafg
    ekltekaigdvfslleklgfkkgskivvhrdgrlyrdevaafkkygelygyslelleiik
    rnnprffsnekfikgyfyklsedsvilatynqvyegthqpikvrkvygelpvevlcsqil
    sltlmnyssfqpiklpatvhysdkitklmlrgiepikkegdimywl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nubA (A:)
    mgkeallnlyrieyrpkdttftvfkptheiqkeklnkvrwrvflqtglptfrredefwca
    gkvekdtlyltlsngeivelkrvgeeefrgfqnerecqelfrdfltktkvkdkfisdfyk
    kfrdkitvqgknrialipevnekvlkseegyfllhldlkfriqpfetlqtllerfnpkri
    rvkpigidfvgrvqdvfkakekgeeffrlcmersthksskkaweellknrelrekaflvv
    lytypatilkpvltyvadivrmepgkrlnliryilrryvkalrdygwyispeeerakgkl
    nfkdtvldakgkntkvitnlrkflelcrpfvkkdvlsveiisvsvykklewrkeeflkel
    inflknkgiklkikgkslilaqtreeakeklipvinkikdvdlvivfleeypkvdpyksf
    llydfvkrellkkmipsqvilnrtlknenlkfvllnvaeqvlaktgnipyklkeiegkvd
    afvgidisritrdgktvnavaftkifnskgelvryyltsypafgekltekaigdvfslle
    klgfkkgskivvhrdgrlyrdevaafkkygelygyslelleiikrnnprffsnekfikgy
    fyklsedsvilatynqvyegthqpikvrkvygelpvevlcsqilsltlmnyssfqpiklp
    atvhysdkitklmlrgiepikkegdimywl