PDB entry 2nua

View 2nua on RCSB PDB site
Description: C123aV Mutant of E. coli Succinyl-CoA Synthetase
Class: ligase
Keywords: citric acid cycle, heterotetramer, ligase, ATP-GRASP fold, rossmann fold
Deposited on 2006-11-08, released 2007-07-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.221
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinyl-CoA ligase [ADP-forming] subunit alpha
    Species: Escherichia coli [TaxId:562]
    Gene: sucD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AGE9 (0-End)
      • engineered (122)
    Domains in SCOPe 2.03: d2nuaa1, d2nuaa2
  • Chain 'B':
    Compound: succinyl-coa synthetase beta chain
    Species: Escherichia coli [TaxId:562]
    Gene: sucC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2nuab1, d2nuab2
  • Chain 'D':
    Compound: Succinyl-CoA ligase [ADP-forming] subunit alpha
    Species: Escherichia coli [TaxId:562]
    Gene: sucD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AGE9 (0-End)
      • engineered (122)
    Domains in SCOPe 2.03: d2nuad1, d2nuad2
  • Chain 'E':
    Compound: succinyl-coa synthetase beta chain
    Species: Escherichia coli [TaxId:562]
    Gene: sucC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2nuae1, d2nuae2
  • Heterogens: PO4, SO4, COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nuaA (A:)
    silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
    aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
    pnvpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggd
    pipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapk
    gkrmghagaiiaggkgtadekfaaleaagvktvrsladigealktvlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nuaA (A:)
    silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
    aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
    pnvpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggd
    pipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapk
    gkrmghagaiiaggkgtadekfaaleaagvktvrsladigealktvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nuaB (B:)
    mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
    kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
    vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
    fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqedp
    reaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkervte
    afkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelgakk
    ladsglniiaakgltdaaqqvvaavegk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2nuaD (D:)
    silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
    aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
    pnvpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggd
    pipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapk
    gkrmghagaiiaggkgtadekfaaleaagvktvrsladigealktvlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nuaD (D:)
    silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
    aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
    pnvpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggd
    pipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapk
    gkrmghagaiiaggkgtadekfaaleaagvktvrsladigealktvl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2nuaE (E:)
    mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
    kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
    vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
    fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqedp
    reaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkervte
    afkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelgakk
    ladsglniiaakgltdaaqqvvaavegk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nuaE (E:)
    mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
    kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
    vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
    fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqedp
    reaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkervte
    afkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelgakk
    ladsglniiaakgltdaaqqvvaav