PDB entry 2nu8

View 2nu8 on RCSB PDB site
Description: C123aT Mutant of E. coli Succinyl-CoA Synthetase
Class: ligase
Keywords: citric acid cycle, heterotetramer, ligase, ATP-GRASP fold, Rossmann fold
Deposited on 2006-11-08, released 2007-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.21
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinyl-CoA ligase [ADP-forming] subunit alpha
    Species: Escherichia coli [TaxId:562]
    Gene: sucD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AGE9 (0-End)
      • engineered (122)
    Domains in SCOPe 2.07: d2nu8a1, d2nu8a2
  • Chain 'B':
    Compound: succinyl-coa synthetase beta chain
    Species: Escherichia coli [TaxId:562]
    Gene: sucC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nu8b1, d2nu8b2
  • Chain 'D':
    Compound: Succinyl-CoA ligase [ADP-forming] subunit alpha
    Species: Escherichia coli [TaxId:562]
    Gene: sucD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AGE9 (0-End)
      • engineered (122)
    Domains in SCOPe 2.07: d2nu8d1, d2nu8d2
  • Chain 'E':
    Compound: succinyl-coa synthetase beta chain
    Species: Escherichia coli [TaxId:562]
    Gene: sucC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nu8e1, d2nu8e2
  • Heterogens: PO4, SO4, COA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nu8A (A:)
    silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
    aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
    pntpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggd
    pipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapk
    gkrmghagaiiaggkgtadekfaaleaagvktvrsladigealktvlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nu8A (A:)
    silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
    aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
    pntpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggd
    pipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapk
    gkrmghagaiiaggkgtadekfaaleaagvktvrsladigealktvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nu8B (B:)
    mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
    kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
    vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
    fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqedp
    reaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkervte
    afkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelgakk
    ladsglniiaakgltdaaqqvvaavegk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2nu8D (D:)
    silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
    aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
    pntpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggd
    pipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapk
    gkrmghagaiiaggkgtadekfaaleaagvktvrsladigealktvlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nu8D (D:)
    silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
    aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
    pntpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggd
    pipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapk
    gkrmghagaiiaggkgtadekfaaleaagvktvrsladigealktvl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2nu8E (E:)
    mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
    kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
    vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
    fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqedp
    reaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkervte
    afkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelgakk
    ladsglniiaakgltdaaqqvvaavegk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nu8E (E:)
    mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
    kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
    vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
    fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqedp
    reaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkervte
    afkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelgakk
    ladsglniiaakgltdaaqqvvaav