PDB entry 2nu5

View 2nu5 on RCSB PDB site
Description: Crystal structure of a complex of griffithsin cocrystallized with N-acetylglucosamine
Class: antiviral protein,sugar binding protein
Keywords: griffithsin; lectins; domain swapping; mannose binding; HIV; SARS, ANTIVIRAL PROTEIN, SUGAR BINDING PROTEIN
Deposited on 2006-11-08, released 2007-08-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Griffithsin
    Species: Griffithsia sp. [TaxId:373036]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2nu5a_
  • Chain 'B':
    Compound: Griffithsin
    Species: Griffithsia sp. [TaxId:373036]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2nu5b_
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2nu5A (A:)
slthrkfggsggspfsglssiavrsgsyldaiiidgvhhggsggnlsptftfgsgeyisn
mtirsgdyidnisfetnmgrrfgpyggsggsantlsnvkviqingsagdyldsldiyyeq
y

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2nu5B (B:)
slthrkfggsggspfsglssiavrsgsyldaiiidgvhhggsggnlsptftfgsgeyisn
mtirsgdyidnisfetnmgrrfgpyggsggsantlsnvkviqingsagdyldsldiyyeq
y