PDB entry 2nu4

View 2nu4 on RCSB PDB site
Description: Accommodation of positively-charged residues in a hydrophobic specificity pocket: Crystal structures of SGPB in complex with OMTKY3 variants Lys18I and Arg18I
Class: hydrolase
Keywords: enzyme-inhibitor complex, charged p1 residue
Deposited on 2006-11-08, released 2006-11-21
The last revision prior to the SCOP 1.75 freeze date was dated 2006-11-21, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.17
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Streptogrisin B, Proteinase B
    Species: Streptomyces griseus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2nu4e1
  • Chain 'I':
    Compound: Ovomucoid
    Species: Meleagris gallopavo
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68390 (0-50)
      • engineered (12)
    Domains in SCOP 1.75: d2nu4i1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nu4E (E:)
    isggdaiysstgrcslgfnvrsgstyyfltaghctdgattwwansarttvlgttsgssfp
    nndygivrytnttipkdgtvggqditsaanatvgmavtrrgsttgthsgsvtalnatvny
    gggdvvygmirtnvcaepgdsggplysgtraigltsggsgncssggttffqpvtealsay
    gvsvy
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nu4I (I:)
    vdcseypkpactkeyrplcgsdnktygnkcnfcnavvesngtltlshfgkc