PDB entry 2nu4
View 2nu4 on RCSB PDB site
Description: Accommodation of positively-charged residues in a hydrophobic specificity pocket: Crystal structures of SGPB in complex with OMTKY3 variants Lys18I and Arg18I
Class: hydrolase
Keywords: enzyme-inhibitor complex, charged p1 residue
Deposited on
2006-11-08, released
2006-11-21
The last revision prior to the SCOP 1.75 freeze date was dated
2006-11-21, with a file datestamp of
2007-06-28.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.17
AEROSPACI score: 0.63
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'E':
Compound: Streptogrisin B, Proteinase B
Species: Streptomyces griseus
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d2nu4e1 - Chain 'I':
Compound: Ovomucoid
Species: Meleagris gallopavo
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d2nu4i1 - Heterogens: HOH
PDB Chain Sequences:
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>2nu4E (E:)
isggdaiysstgrcslgfnvrsgstyyfltaghctdgattwwansarttvlgttsgssfp
nndygivrytnttipkdgtvggqditsaanatvgmavtrrgsttgthsgsvtalnatvny
gggdvvygmirtnvcaepgdsggplysgtraigltsggsgncssggttffqpvtealsay
gvsvy
- Chain 'I':
Sequence; same for both SEQRES and ATOM records: (download)
>2nu4I (I:)
vdcseypkpactkeyrplcgsdnktygnkcnfcnavvesngtltlshfgkc