PDB entry 2nu3

View 2nu3 on RCSB PDB site
Description: Accommodation of positively-charged residues in a hydrophobic specificity pocket: Crystal structures of SGPB in complex with OMTKY3 variants Lys18I and Arg18I
Class: hydrolase
Keywords: enzyme-inhibitor complex, charged p1 residue, hydrolase
Deposited on 2006-11-08, released 2006-11-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.148
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Streptogrisin B, Proteinase B
    Species: Streptomyces griseus [TaxId:1911]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2nu3e_
  • Chain 'I':
    Compound: Ovomucoid
    Species: Meleagris gallopavo [TaxId:9103]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68390 (0-50)
      • engineered (12)
    Domains in SCOPe 2.08: d2nu3i_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2nu3E (E:)
isggdaiysstgrcslgfnvrsgstyyfltaghctdgattwwansarttvlgttsgssfp
nndygivrytnttipkdgtvggqditsaanatvgmavtrrgsttgthsgsvtalnatvny
gggdvvygmirtnvcaepgdsggplysgtraigltsggsgncssggttffqpvtealsay
gvsvy

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2nu3I (I:)
vdcseypkpactkeyrplcgsdnktygnkcnfcnavvesngtltlshfgkc