PDB entry 2nu1

View 2nu1 on RCSB PDB site
Description: Molecular structures of the complexes of SGPB with OMTKY3 aromatic P1 variants Trp18I, His18I, Phe18I and Tyr18I
Class: hydrolase
Keywords: enzyme-inhibitor complex, aromatic p1 residue
Deposited on 2006-11-08, released 2006-11-21
The last revision prior to the SCOP 1.75 freeze date was dated 2006-11-21, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.163
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Streptogrisin B
    Species: Streptomyces griseus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2nu1e1
  • Chain 'I':
    Compound: Ovomucoid
    Species: Meleagris gallopavo
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68390 (0-50)
      • engineered (12)
    Domains in SCOP 1.75: d2nu1i1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2nu1E (E:)
isggdaiysstgrcslgfnvrsgstyyfltaghctdgattwwansarttvlgttsgssfp
nndygivrytnttipkdgtvggqditsaanatvgmavtrrgsttgthsgsvtalnatvny
gggdvvygmirtnvcaepgdsggplysgtraigltsggsgncssggttffqpvtealsay
gvsvy

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2nu1I (I:)
vdcseypkpactheyrplcgsdnktygnkcnfcnavvesngtltlshfgkc