PDB entry 2nu0
View 2nu0 on RCSB PDB site
Description: Molecular structures of the complexes of SGPB with OMTKY3 aromatic P1 variants Trp18I, His18I, Phe18I, and Tyr18I
Class: hydrolase
Keywords: enzyme-inhibitor complex, aromatic p1 residue, hydrolase
Deposited on
2006-11-08, released
2006-11-21
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.145
AEROSPACI score: 0.51
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'E':
Compound: Streptogrisin B, Protease B
Species: Streptomyces griseus [TaxId:1911]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2nu0e_ - Chain 'I':
Compound: Ovomucoid
Species: Meleagris gallopavo [TaxId:9103]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2nu0i1 - Heterogens: HOH
PDB Chain Sequences:
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>2nu0E (E:)
isggdaiysstgrcslgfnvrsgstyyfltaghctdgattwwansarttvlgttsgssfp
nndygivrytnttipkdgtvggqditsaanatvgmavtrrgsttgthsgsvtalnatvny
gggdvvygmirtnvcaepgdsggplysgtraigltsggsgncssggttffqpvtealsay
gvsvy
- Chain 'I':
Sequence; same for both SEQRES and ATOM records: (download)
>2nu0I (I:)
vdcseypkpactweyrplcgsdnktygnkcnfcnavvesngtltlshfgkc