PDB entry 2nu0

View 2nu0 on RCSB PDB site
Description: Molecular structures of the complexes of SGPB with OMTKY3 aromatic P1 variants Trp18I, His18I, Phe18I, and Tyr18I
Class: hydrolase
Keywords: enzyme-inhibitor complex, aromatic p1 residue, hydrolase
Deposited on 2006-11-08, released 2006-11-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.145
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Streptogrisin B, Protease B
    Species: Streptomyces griseus [TaxId:1911]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2nu0e_
  • Chain 'I':
    Compound: Ovomucoid
    Species: Meleagris gallopavo [TaxId:9103]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68390 (0-50)
      • engineered (12)
    Domains in SCOPe 2.08: d2nu0i1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nu0E (E:)
    isggdaiysstgrcslgfnvrsgstyyfltaghctdgattwwansarttvlgttsgssfp
    nndygivrytnttipkdgtvggqditsaanatvgmavtrrgsttgthsgsvtalnatvny
    gggdvvygmirtnvcaepgdsggplysgtraigltsggsgncssggttffqpvtealsay
    gvsvy
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nu0I (I:)
    vdcseypkpactweyrplcgsdnktygnkcnfcnavvesngtltlshfgkc